PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna25733.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB_related
Protein Properties Length: 359aa    MW: 38691.2 Da    PI: 7.0929
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna25733.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding408.9e-13105151147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              r +WT+eE+  ++ + ++lG+g+W+ Iar    +Rt+ q+ s+ qky
  mrna25733.1-v1.0-hybrid 105 RVPWTEEEHRMFLIGLQKLGKGDWRGIARNYVITRTPTQVASHAQKY 151
                              789*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.103.0E-4230IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.024100156IPR017930Myb domain
SuperFamilySSF466891.22E-16102157IPR009057Homeodomain-like
SMARTSM007177.4E-10104154IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.6E-18105155IPR006447Myb domain, plants
PfamPF002493.2E-11105151IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-11105150IPR009057Homeodomain-like
CDDcd001678.14E-9107152No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPS RGGGASSSCS SGSGGVRLFG VKLTDGSIIK KSASMGNLST  60
MASHYQSSSP NPDSPPLHDP VHVRDGYLSD DPAHASSSAN RRGDRVPWTE EEHRMFLIGL  120
QKLGKGDWRG IARNYVITRT PTQVASHAQK YFIRQSNSNR RKRRSSLFDM APDMAMDSPH  180
MPEEQALLPS CQEERESEDS NALPSLNLSL GSECSRPMES TQEDNIVIKP DNQSVMGFNG  240
YPNGYPPVIP GFIPAYVPFP FPVWPSAGPL IIENGGDASH YPQVLKPVPI LPKEPVNVDA  300
LVGMSQLNLG EAETLQSNPS SLSMTSLGEP SRQSAFHPNA PASEPDLSKG KTSVIQAV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9674410.0GU967441.1 Rosa rugosa putative MYB transcription factor-like (MYB2) mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004302861.10.0PREDICTED: transcription factor MYB1R1
TrEMBLM5X5I71e-161M5X5I7_PRUPE; Uncharacterized protein
STRINGGLYMA13G43120.11e-141(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.13e-93MYB_related family protein